SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004022 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004022
Domain Number 1 Region: 305-376
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000375
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004022   Gene: ENSGGOG00000004094   Transcript: ENSGGOT00000004119
Sequence length 380
Comment pep:known_by_projection chromosome:gorGor3.1:2a:59262782:59344746:-1 gene:ENSGGOG00000004094 transcript:ENSGGOT00000004119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLR
TILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGT
LGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQ
VNSPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVS
INIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPAR
AILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNII
FGECPYCSKPITLKMSGRKH
Download sequence
Identical sequences G3QNB0
ENSGGOP00000004022 9606.ENSP00000385021 NP_001108108.1.87134 NP_001108108.1.92137 gi|167860138|ref|NP_001108108.1| ENSGGOP00000004022 ENSP00000385021 ENSP00000385021 ENSP00000385021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]