SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004073 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004073
Domain Number 1 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.01e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 391-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 23-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 520-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-19
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000356
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 437-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000124
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004073   Gene: ENSGGOG00000004150   Transcript: ENSGGOT00000004173
Sequence length 594
Comment pep:known_by_projection chromosome:gorGor3.1:19:55142341:55149652:-1 gene:ENSGGOG00000004150 transcript:ENSGGOT00000004173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLRDSTSVPMTAEAKLMGFTQGCVTFEDVAIYFSQEEWGLLDEAQRLLYRDVMLEN
FALITALVCWHGMEDEETPEQSVSVEGVPQVRTPEASPSTQKIQSCDMCVPFLTDILHLT
DLPGQELYLTGACAVFHQDQKHHSAEKPLESDMDKASFVQCCLFHESGMPFTSSEVGKDF
LAPLRILQPQAIANYEKPNKISKCEEAFHVGISHYKWSQCRRESSHKHTFFHPRVCTGKR
LYESSKCGKACCCECSLVQLQRVHPGERPYECSECGKSFSQTSHLNDHRRIHTGERPYVC
GQCGKSFSQRATLIKHHRVHTGERPYECGECGKSFSQSSNLIEHCRIHTGERPYECDECG
KAFGSKSTLVRHQRTHTGEKPYECGECGKLFRQSFSLVVHQRIHTTARPYECGQCGKSFS
LKCGLIQHQLIHSGARPFECDECGKSFSQRTTLNKHHKVHTAERSYVCGECGKAFMFKSK
LVRHQRTHTGERPFECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQH
QVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV
Download sequence
Identical sequences G3QNF8
XP_004061598.1.27298 ENSGGOP00000004073 ENSGGOP00000001566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]