SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004234 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004234
Domain Number 1 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 17-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 392-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 200-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004234   Gene: ENSGGOG00000004318   Transcript: ENSGGOT00000004337
Sequence length 460
Comment pep:known_by_projection chromosome:gorGor3.1:19:49755635:49773097:1 gene:ENSGGOG00000004318 transcript:ENSGGOT00000004337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCDEEAQKRKAKESGMALPQGHLTFMDVAIEFSQEEWKSLHPGQRALYRDVMLENYRNL
VFLGICLPDLSIISMLKQRREPLTLQSQVKIVKTTDGRECVRSVNTGRSCVLGSNAENKP
IKNQLGLTLEPHLSELQLFQAGRKIYRSNQVEKFTNHHSSVSPLQKISSSFTTHIFNKYR
NDLIDFPLLPQEEKAYIRGKSYECSEDGEVFRVPASLTNHQVIHTAEKPYKCTECGKVFS
RNSHLVEHWRIHTGQKPYKCSECDKVFNRNSNLARHQRIHTGEKPHKCNECGKAFRECSG
LTTHLVIHTGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKPYKCNECGKVFSLLSYLARH
QIIHSTEKPYKCNECGKAFRKRPGLMAHLLIHTGEKPYKCNECDKVFGRKLYLTNHQRIH
TGERPYKCNACGKVFNQNPHLSRHRKIHAGENSLRTLQME
Download sequence
Identical sequences G3QNV6
ENSGGOP00000004234 ENSGGOP00000004234 XP_004061385.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]