SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004296 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004296
Domain Number 1 Region: 114-410
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-64
Family Nuclear receptor ligand-binding domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 44-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.07e-29
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004296   Gene: ENSGGOG00000004383   Transcript: ENSGGOT00000004403
Sequence length 410
Comment pep:known_by_projection chromosome:gorGor3.1:15:51303636:51310746:1 gene:ENSGGOG00000004383 transcript:ENSGGOT00000004403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TETRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYG
IYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQN
ERQPRSTAQVRLDSMESNTEPRLESLVVPPAPAGPSPRGPTPISAARALGHHFMASLITA
ETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPV
FSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMET
RVLRETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAH
HPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences G3QP13
ENSGGOP00000004296 ENSGGOP00000004296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]