SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004426 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004426
Domain Number 1 Region: 90-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 8-70
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000804
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 325-371
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000303
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004426   Gene: ENSGGOG00000004513   Transcript: ENSGGOT00000004536
Sequence length 377
Comment pep:known_by_projection chromosome:gorGor3.1:1:135079935:135084983:-1 gene:ENSGGOG00000004513 transcript:ENSGGOT00000004536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTECVPVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDVATARR
EIISAAEHFSMIRASRNKSGAAFGVAPALPGQVTIRVRVPYRVVGLVVGPKGATIKRIQQ
QTNTYIITPSRDRDPVFEITGAPGNVERAREEIETHIAVRTGKILEYNNENDFLAGSPDA
AIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSGFEAPRLGEQGGDFGYGGYLFP
GYGVGKQDVYYGVAETSPPLWAGQENATPTSVPKARAGPPGAHRSPATSAGPELAGLPRR
PPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAALVPCGHNLFCMECAVRICERTDP
ECPVCHITATQAIRIFS
Download sequence
Identical sequences ENSGGOP00000004426 ENSGGOP00000004426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]