SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004464 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004464
Domain Number 1 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000012
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004464   Gene: ENSGGOG00000002384   Transcript: ENSGGOT00000004576
Sequence length 501
Comment pep:known_by_projection chromosome:gorGor3.1:X:48811649:48818656:-1 gene:ENSGGOG00000002384 transcript:ENSGGOT00000004576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVFVGQQVTKPNLILKLEVEEC
PAEGKIPFWNFPRDCHEFGNILHLSTNLVASIQRPDTRGNNMVDNLDLFSRSSAENKYDN
GCAKLFFHTEYEKTNPGVKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSK
KSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFREKSTV
IIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLDLIIHH
STHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVHQRTHT
GEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKP
YECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEKPYECP
VCWKAFSQKSQLIIHQRTHTG
Download sequence
Identical sequences ENSGGOP00000004464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]