SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004478 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000004478
Domain Number - Region: 56-133
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0295
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004478   Gene: ENSGGOG00000004568   Transcript: ENSGGOT00000004593
Sequence length 158
Comment pep:known_by_projection chromosome:gorGor3.1:5:56032672:56039762:1 gene:ENSGGOG00000004568 transcript:ENSGGOT00000004593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELK
EECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQ
ALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
Download sequence
Identical sequences A0A2I2ZW01 A0A2J8LHX8 A0A2J8TM88 A0A2K6U3E5
9598.ENSPTRP00000015209 ENSP00000462871 ENSP00000464443 ENSP00000350570 ENSP00000458458 ENSGGOP00000004478 ENSP00000464443 NP_001254703.1.87134 NP_001254703.1.92137 XP_003812713.1.60992 XP_003953143.1.37143 XP_004042102.1.27298 XP_010340336.1.74449 XP_010340337.1.74449 XP_017391509.1.71028 ENSGGOP00000004478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]