SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004501 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004501
Domain Number 1 Region: 272-457
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.54e-61
Family acyl-CoA oxidase C-terminal domains 0.0000000326
Further Details:      
 
Domain Number 2 Region: 469-653
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.3e-59
Family acyl-CoA oxidase C-terminal domains 0.0000000834
Further Details:      
 
Domain Number 3 Region: 2-262
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.44e-53
Family acyl-CoA oxidase N-terminal domains 0.00000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004501   Gene: ENSGGOG00000004590   Transcript: ENSGGOT00000004616
Sequence length 660
Comment pep:known_by_projection chromosome:gorGor3.1:5:7267021:7302530:1 gene:ENSGGOG00000004590 transcript:ENSGGOT00000004616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRY
EVAVRKSAIMVKKMREFGIADPDEIMWFKKLHLVNFVEPVGLNYSMFIPTLLNQGTTAQK
EKWLLSSKGLQIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIA
IRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIG
QGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTF
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSP
ESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFS
EKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIR
SDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL
Download sequence
Identical sequences G3QPK4
XP_004041079.1.27298 ENSGGOP00000004501 ENSGGOP00000004501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]