SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004640 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004640
Domain Number 1 Region: 539-645
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 771-877
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 3 Region: 331-436
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00096
Further Details:      
 
Domain Number 4 Region: 228-331
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 5 Region: 25-130
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 
Domain Number 6 Region: 437-539
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00046
Further Details:      
 
Domain Number 7 Region: 644-752
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0032
Further Details:      
 
Domain Number 8 Region: 132-230
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004640   Gene: ENSGGOG00000004739   Transcript: ENSGGOT00000004760
Sequence length 921
Comment pep:novel chromosome:gorGor3.1:10:147483320:147495891:1 gene:ENSGGOG00000004739 transcript:ENSGGOT00000004760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAALWTLGLGPLLLNLWEVPIGGPGALRLAYRHSTCDGVVLVRHHGAWGYVCNQEWTLA
EASVVCRQLGCGPAVGAPKYVPLPGEMAQPWLHNVSCRGNESSLWECSLGSWCQSPCPHA
WVVVALCSHGTFRELRLVKGRSPCAGLPEIRNVNGVDRLCGLHVEEAMVFCRELGCGPVL
QAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVICSGHTEARLVGGEHP
CAGRLEVKRGLTWGTVCDADLDLATAHVVCRELQCGAVVSTPKGARFGRGLGPVWTEAFR
CAGNESLLFHCPRGRGSQCGHGHDAGLRCSEFRMVNGSSSCEGRVELQVQGSWAPLCATH
WDIADATVLCHQLNCGNAVAAPGGGHFGDGDAAIWPDAFHCEGTEPYLWNCPVSTLGAPA
CAPGNTASAVCSGLPHALRLREGQSRCDGRVEVSLDGVWGRVLDDAWDLRGAGVVCRQLG
CGGAEQAYDAPAPSRGSVQVALSRVRCLGTETRLTQCNVSATLQEPAGTSRDAGVVCSGS
LGVRLAAGPGRCAGRVEVLHGGAWGTVCDDAWDLRDAHVVCRQLGCGRALSALGAAHFGA
GAGRIWLDELGCQGHESALWQCPSAGWGRHDCRHKEDAGVFCSESVALRLRGGTCCCAGW
LDVFYNGTWGAVCSNALKDLSLSIICKQLGCGEWGWLENRPFPSAGTGTAWVDNIECRRL
PNSTLWQCPSHPWHPHSCDLREQVWITCAGLSADRPQAAGEPLNCSSWLGCPEEGALRVR
GGEDRCSGRVELWHAGSWGTVCDDGWDLADAEVVCRQLGCGRAVAALGAAAFGPGSGPVW
LDEVGCRGSEASLWGCPAERWGRGDCAHKEDAGVRCWVYSSPCSFRPGPGPPLPAAPFQT
FWVVSVVLGALLGLLLLGLMA
Download sequence
Identical sequences ENSGGOP00000004640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]