SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004653 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004653
Domain Number 1 Region: 166-227
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.95e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 2 Region: 224-287
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.19e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 130-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000143
Family LIM domain 0.00087
Further Details:      
 
Domain Number 4 Region: 9-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000228
Family LIM domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004653
Domain Number - Region: 283-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0419
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004653   Gene: ENSGGOG00000004750   Transcript: ENSGGOT00000004773
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:2b:14622255:14640246:-1 gene:ENSGGOG00000004750 transcript:ENSGGOT00000004773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSPAPSNMSDALANAVCQRCQARFSPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYE
ESEGPKHSASPTQACEWQCGQAVGPEQPAARNQKRSWHPACAHCGSRSPSLPSVGRRGGR
HLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEAREL
KGELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKK
GLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFD
MKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPKAADLNSA
Download sequence
Identical sequences ENSGGOP00000004653 ENSGGOP00000004653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]