SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004703 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004703
Domain Number 1 Region: 30-136
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 310-412
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 420-537
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 172-293
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004703
Domain Number - Region: 657-740
Classification Level Classification E-value
Superfamily DNase I-like 0.0863
Family DNase I-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004703   Gene: ENSGGOG00000004798   Transcript: ENSGGOT00000004823
Sequence length 757
Comment pep:known_by_projection chromosome:gorGor3.1:10:111633734:111654228:-1 gene:ENSGGOG00000004798 transcript:ENSGGOT00000004823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
NFAIQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCAGTESSLDQCGSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTKPQ
HKGSWAEQEPRVRLRSGAQVGQGRVEVLVNRQWGTVCDHRWNLISASVVCRQLGFGSARE
ALFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQN
QVRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETW
FWSGTPRAQQVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNA
QLVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPK
TGRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACA
NFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRC
KYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI
Download sequence
Identical sequences ENSGGOP00000004703 ENSGGOP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]