SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004929 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004929
Domain Number 1 Region: 29-169
Classification Level Classification E-value
Superfamily Cupredoxins 1.03e-48
Family Ephrin ectodomain 0.00000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004929   Gene: ENSGGOG00000005033   Transcript: ENSGGOT00000005056
Sequence length 340
Comment pep:known_by_projection chromosome:gorGor3.1:17:7909950:7916118:1 gene:ENSGGOG00000005033 transcript:ENSGGOT00000005056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAAPRKP
VSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
Download sequence
Identical sequences G3QQQ6
ENSGGOP00000004929 ENSGGOP00000004929 XP_004058561.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]