SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005100 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005100
Domain Number 1 Region: 773-881
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 253-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 4-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 160-295
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 615-770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000115
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005100   Gene: ENSGGOG00000005201   Transcript: ENSGGOT00000005231
Sequence length 959
Comment pep:known_by_projection chromosome:gorGor3.1:22:27577609:27722099:-1 gene:ENSGGOG00000005201 transcript:ENSGGOT00000005231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGKQCEDIDECENDYYNGGCVH
ECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECQCHSGFFL
SDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNYG
NGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSCPV
GFTLQPDGKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSF
ERTCDHTCINSPGSFQCLCHRGYILYGTTHCGDVDECSMSNGSCDQGCVNTKGSYECVCP
PGRRLHWNRKDCVETGKCLSRAKTSPRAQLSCSKAGGVESCFLSCPAHTLFVPDSENSYV
LSCGVPGPQGKALQKRNGTSSGLGPSCSGAPTTPIKQKARFKIRDAKCHLWPHSQTRAKE
TARQPLLDHCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEIETKMEETSDTCEADC
LRKRAEQSLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQGACGAGQVLQDSK
CVACGPGTHFGGELGQCVPCMPGTYQDMEGQLSCTPCPSSDGLGLAGARNVSECGGQCSP
GFFSADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHHY
NTTTHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYI
ESPNYPGDYPANAECVWHIAPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTY
ETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYA
SENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSGGOP00000005100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]