SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000005161

Domain assignment for ENSGGOP00000005161 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000005161
Domain Number 1	Region: 171-291
Classification Level	Classification	E-value
Superfamily	cAMP-binding domain-like	3.4e-16
Family	cAMP-binding domain	0.011
Further Details:

Domain Number 2	Region: 3-70,110-161
Classification Level	Classification	E-value
Superfamily	cAMP-binding domain-like	0.0000000912
Family	cAMP-binding domain	0.032
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000005161 Gene: ENSGGOG00000005268 Transcript: ENSGGOT00000005295
Sequence length	294
Comment	pep:known_by_projection chromosome:gorGor3.1:8:85907775:86084887:1 gene:ENSGGOG00000005268 transcript:ENSGGOT00000005295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LRPIHRTPYEHKTVWKFLKTIPDLTFQLNDKHLKTLSKTVFSETWLKGSTVVANDGFYVI LKGLARPQTNVYKNLIEGSDSPDSFIPQSFHSFIWSEEFKNSTLAEMYLPSYDSMLSKWS TFGTLEVIPQIESETQMFSVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPY YEEWPTLSIYELIALLKWKKFPPGHVIVESGNIISFVGYINSGCCNIYRSIIGFVKLRSN KVKRSQKLVYMGKLKEKESFGEISVLLQVPFTCTIITKKEVEMAVIEDKDLFVA
Download sequence
Identical sequences	ENSGGOP00000005161 ENSGGOP00000005161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]