SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005189 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005189
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 427-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.95e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 29-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 6 Region: 469-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000108
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 222-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000694
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005189
Domain Number - Region: 171-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0924
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005189   Gene: ENSGGOG00000004515   Transcript: ENSGGOT00000005325
Sequence length 577
Comment pep:known_by_projection chromosome:gorGor3.1:19:55255976:55415702:1 gene:ENSGGOG00000004515 transcript:ENSGGOT00000005325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPVGRRSPPSPRSSMAAVTLRDSAQGMTFEDVAIYFSQEEWELLDESQRFLYCDVMLE
NFAHVTSLGYCHGMENEAIASEQSVSIQVRTSKGNTPTQKTHLSEIKMCVPVLKDILPVA
EHQTTSPVQKSYLGSTSMRGFCFSADLHQHQKHYNEEEPWKRKVDEATFVTGCRFHVLNY
FTCGEAFPAPMDLLQHEATPSGEEPHSSSSKHIQAFFNAKSYYKWGEYRKASSHKHTLVQ
HRNVCSEGGLYECSKCEKAFTCKNTLVEHQQIHTGQKMFECSECEESFSKKCHLILHKII
HTGERPYECSDREKAFIHKSEFIHHQRRHTGGVRHECGECRKTFSYKSNLIEHQRVHTGE
RPYECGECGKSFRQSSSLFRHQRVHSGERPYQCCECGKSFRQIFNLIRHRRVHTGEMPYQ
CSDCGKSFSCKSELIQHQRIHSGERPYECRECGKSFRQFSNLIRHRSIHTGDRPYECSEC
XXXXSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRESSVFSESGKDF
LPRSGLLQQEASDTGEKSNSKTECVSPFQCGGAHYSH
Download sequence
Identical sequences ENSGGOP00000005189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]