SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005220 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005220
Domain Number 1 Region: 350-428
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.12e-25
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 122-155
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000424
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005220
Domain Number - Region: 233-348
Classification Level Classification E-value
Superfamily Prefoldin 0.000314
Family Prefoldin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005220   Gene: ENSGGOG00000005328   Transcript: ENSGGOT00000005356
Sequence length 479
Comment pep:known_by_projection chromosome:gorGor3.1:5:42509432:42513880:1 gene:ENSGGOG00000005328 transcript:ENSGGOT00000005356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCSRQFTSSSSMKGSCGIGGGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSR
FSSGGAYGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGFSGGLGAGFGGGFAGSDGLLV
GSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDL
RNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVGADINGMRGVLDELTLAR
ADLEMQIESLKEELALKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEK
MAEKNHKDAEERFFTKTEELNHEVATNSELVQSSKSEISELWRTMQNLEIELQSQLSMKA
SLENSLEETKGRYCVQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKMRLEQEIA
TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Download sequence
Identical sequences ENSGGOP00000005220 ENSGGOP00000005220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]