SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005250 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005250
Domain Number 1 Region: 11-247
Classification Level Classification E-value
Superfamily Pseudouridine synthase 9.06e-51
Family Pseudouridine synthase I TruA 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005250   Gene: ENSGGOG00000005364   Transcript: ENSGGOT00000005387
Sequence length 262
Comment pep:known_by_projection chromosome:gorGor3.1:1:1181872:1184428:1 gene:ENSGGOG00000005364 transcript:ENSGGOT00000005387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLR
HPAISHRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWALPADCLD
VVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLQFCN
LEFESQSFLYRQVRRMTAVLVAVGLGTLAPAQVKTILESQDPLGKHQTRVAPAHGLFLKS
VLYGNLGAASCTLQGPQFGSHG
Download sequence
Identical sequences ENSGGOP00000005250 ENSGGOP00000005250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]