SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005334 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005334
Domain Number 1 Region: 55-162
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 471-574
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 3 Region: 187-292
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 342-446
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005334   Gene: ENSGGOG00000005447   Transcript: ENSGGOT00000005475
Sequence length 575
Comment pep:known_by_projection chromosome:gorGor3.1:7:73464200:73484616:-1 gene:ENSGGOG00000005447 transcript:ENSGGOT00000005475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEAEMLIGPQLDEKRWGWRLGDGSAAPPFLPQALSFLLLLPLASTLQPTPLPFQELRL
VGGPSRCQGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRKMLTSRAPPMTL
PNGKSEGSVRLVGGANLCQGRVEIMHSGLWGTVCDDDWGLPDAAVVCRQLGCGAAMAATT
NAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCAGLGPPTLTALP
SSATKEDWAWQTDPSATGVGPQPSRETALLTTAAWAAGKKSGRLRLVGGPGPCRGRVEVL
HAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARL
SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAH
RCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNV
KCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Download sequence
Identical sequences G3QRS1
ENSGGOP00000005334 XP_004045670.1.27298 ENSGGOP00000005334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]