SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005395 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005395
Domain Number 1 Region: 360-426
Classification Level Classification E-value
Superfamily RING/U-box 4.18e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005395
Domain Number - Region: 289-299
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00178
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005395   Gene: ENSGGOG00000005510   Transcript: ENSGGOT00000005537
Sequence length 432
Comment pep:known_by_projection chromosome:gorGor3.1:5:161094813:161098404:-1 gene:ENSGGOG00000005510 transcript:ENSGGOT00000005537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPWALAVTRWPPSAPVGQRRFSAGPGSTPGQLWGSPGLEGPLASPPARDERLPSQQPPS
RPPHLPVEERRASAPAGGSPRMLHPATQQSPFMVDLHEQVHQGPVPLSYTVTTVTTQGFP
LPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPLIQACTMQQLPVPYQAYPHLISSDH
YILHPPPPAPPPQPTHMAPLGQFVSXXXXXXXXXXXXXXXXXXXRGDQPSLGSFTYSTSA
PGPALSPSVPLHYLPHDPLHQELSFGVPYSHMMPRRLSTQRYRLQQPLPPPPPPPPPPPY
YPSFLPYFLSMLPMSPTAMGPTISLDLDVDDVEMENYEALLNLAERLGDAKPRGLTKADI
EQLPSYRFNPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPIC
RADASEVPREAE
Download sequence
Identical sequences ENSGGOP00000017461 ENSGGOP00000005395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]