SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005468 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005468
Domain Number 1 Region: 253-306
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-20
Family RING finger domain, C3HC4 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005468   Gene: ENSGGOG00000005584   Transcript: ENSGGOT00000005612
Sequence length 311
Comment pep:known_by_projection chromosome:gorGor3.1:18:43862970:43984922:1 gene:ENSGGOG00000005584 transcript:ENSGGOT00000005612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQS
QPGLSAHMAPAHQHSGALHQSLTPLPTLQFXRSQERVSVHPHRLHPSFDFGQLQTPQPRY
LAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPY
PQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRP
QDGKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICR
VDIETQLGADS
Download sequence
Identical sequences ENSGGOP00000005468 ENSGGOP00000005468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]