SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005606 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005606
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-44
Family Dual specificity phosphatase-like 0.0000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005606   Gene: ENSGGOG00000005725   Transcript: ENSGGOT00000005751
Sequence length 212
Comment pep:known_by_projection chromosome:gorGor3.1:14:35194106:35217363:1 gene:ENSGGOG00000005725 transcript:ENSGGOT00000005751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLPLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDVFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTICLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPQQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Download sequence
Identical sequences G3QSG9
ENSGGOP00000005606 ENSGGOP00000005606 XP_004055240.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]