SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005670 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005670
Domain Number 1 Region: 244-338
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.26e-36
Family Small-conductance potassium channel 0.00000507
Further Details:      
 
Domain Number 2 Region: 154-286
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-23
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005670
Domain Number - Region: 345-402
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0157
Family Outer membrane efflux proteins (OEP) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005670   Gene: ENSGGOG00000005791   Transcript: ENSGGOT00000005819
Sequence length 420
Comment pep:known_by_projection chromosome:gorGor3.1:19:18336082:18359188:1 gene:ENSGGOG00000005791 transcript:ENSGGOT00000005819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPRAACSEPNPCTQVVMNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQ
VVVAKSEPARPSPGSPRGQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKR
KRLSDYALIFGMFGIVVMVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAR
EIQYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA
VVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARVRKH
QRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLA
TLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPSDCG
Download sequence
Identical sequences ENSGGOP00000005670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]