SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005843 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000005843
Domain Number - Region: 432-470
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000252
Family Erythroid transcription factor GATA-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005843   Gene: ENSGGOG00000005973   Transcript: ENSGGOT00000006000
Sequence length 653
Comment pep:known_by_projection chromosome:gorGor3.1:19:19818503:19891166:1 gene:ENSGGOG00000005973 transcript:ENSGGOT00000006000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWPWPTGRTGTPYPEARMTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLN
TDGDMRVTPEPGAGPAQGLLRATEATAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSP
DVIVLSDNEQPSSPRVNGLTTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVL
LKKLRQSQIQKEATAQKPTGSVGSAVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPP
PLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQI
QGQRIIQQGLIRVANVPNTSLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSTESP
ASRQAAAKLALRKQLEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQ
AGRMSAATVLSREPYMCAQCKTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKA
AFVKALQQEQEIEQRLLQQGAAPAQAKAEPTATPHPALKQVIKPRRKLAFRSGEARDWSN
GAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSAT
SNWKKTPLSTGGTLAFVSPSLAVHKSSSAVERQREYLLDMIPPRSIPQSATWK
Download sequence
Identical sequences ENSGGOP00000005843 XP_018871347.1.27298 ENSGGOP00000023241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]