SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005976 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005976
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.06e-26
Family Cell cycle control phosphatase, catalytic domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 188-280
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-16
Family Dual specificity phosphatase-like 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005976   Gene: ENSGGOG00000006108   Transcript: ENSGGOT00000006135
Sequence length 292
Comment pep:novel chromosome:gorGor3.1:3:53385903:53390471:-1 gene:ENSGGOG00000006108 transcript:ENSGGOT00000006135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMPCKSAEWLQEELAARVGASLLLLDYRPHELFESSHIETAINLAIPGLMLRRLRKGNLP
IRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKLRDDGCQAYY
LQGGFNKFQTEYSEHCETNVDSSSSPSSSPPTSVLGLGGLRISSDCSDGESDRELPSSAT
ESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGE
FTYKQIPISDHWSQNLSQFFPEAISFIGRCCVLGGGVWVHQGVCRTLGGAPA
Download sequence
Identical sequences ENSGGOP00000005976 ENSGGOP00000005976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]