SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006011 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006011
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 448-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-19
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 7 Region: 244-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000177
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 126-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000143
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006011   Gene: ENSGGOG00000006145   Transcript: ENSGGOT00000006173
Sequence length 561
Comment pep:known_by_projection chromosome:gorGor3.1:10:41534752:41562977:1 gene:ENSGGOG00000006145 transcript:ENSGGOT00000006173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITSQGSVSFRDVTVGFTQEEWQHLDPAQRTLYRDVMLENYSHLVSVGYCIPKPEVILKL
EKGEEPWILEEKFPSQSHLELINTSRNYSIMKFNEFNKGGKCFCDEKHEIIHSEEEPSEY
NKNGNSFWLNEDLIWHQKIKNWEQSFEYIECGKAFPENSLFLVHKRGYTGQKTCKYTEHG
KTCDMSFFITHQQTHPRENHYGNECGENIFEESILLEHQSVYPFSQKLNLTPIQRTHSIN
NIIEYNECGTFFSEKLVLHLQQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKHYE
CHKCGKTFYKNSDLIKHQRIHTGERPYGCHECGKSFSEKSTLTQHQRTHTGEKPYECHEC
GKTFSFKSVLTVHQKTHTGEKPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSF
SEKSTLTKHLRTHTGEKPYECIQCGKFFCYYSGFTEHLRRHTGEKPFGCNECGKTFRQKS
ALIVHQRTHIRQKPYGCNQCGKSFCVKSKLIAHHRTHTGEKPYECNVCGKSFYVKSKLTV
HQRIHLGRNPINVVNEGNYSG
Download sequence
Identical sequences G3RNJ1
ENSGGOP00000006011 XP_018891047.1.27298 XP_018891048.1.27298 XP_018891049.1.27298 XP_018891050.1.27298 XP_018891051.1.27298 XP_018891052.1.27298 ENSGGOP00000006011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]