SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006012 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006012
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006012   Gene: ENSGGOG00000006147   Transcript: ENSGGOT00000006174
Sequence length 198
Comment pep:known_by_projection chromosome:gorGor3.1:4:184141249:184143228:-1 gene:ENSGGOG00000006147 transcript:ENSGGOT00000006174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSH
YGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIK
TLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKK
TKGRTGWPQHVWALELKQ
Download sequence
Identical sequences G3QTI7
ENSGGOP00000006012 ENSGGOP00000006012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]