SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006159 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006159
Domain Number 1 Region: 294-401
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-26
Family SH2 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006159   Gene: ENSGGOG00000006297   Transcript: ENSGGOT00000006325
Sequence length 431
Comment pep:known_by_projection chromosome:gorGor3.1:10:93477330:93587849:1 gene:ENSGGOG00000006297 transcript:ENSGGOT00000006325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWKERETWEALAQDEGLRPPKTK
RASDKHIQWLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQREAEELWREKEA
EITKKFRDALANEKARILAEKWKVEMEDRKAAKVLEERIHEEFKRKEEEERKRGEEQIRL
QEEQRAKELYWTLKQAQLHCQASEKEEREWEEQLRRSKAADEERSRRAQRARDEYRRHSL
RAIQKGTVAGLSSMFRELGQSHEQEARLYHHLPGPGPPQPLALPVRTWERPLRPVSRDVI
VRWFKEEQLPRRAGFERNTKFIAPWFHGIISREDAEALLENMTEGAFLVRVSEKIWGYTL
SYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLVDFHKEEIITVSGGELLQEPCGQR
DSPPDYHLLFE
Download sequence
Identical sequences ENSGGOP00000006159 ENSGGOP00000006159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]