SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006200 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006200
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 43-148
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00033
Further Details:      
 
Domain Number 3 Region: 415-530
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 4 Region: 185-283
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006200   Gene: ENSGGOG00000006334   Transcript: ENSGGOT00000006366
Sequence length 755
Comment pep:known_by_projection chromosome:gorGor3.1:2a:75913214:75933677:-1 gene:ENSGGOG00000006334 transcript:ENSGGOT00000006366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTGPEKKAGSQGLRFRLAGFPRKPYEGRVEI
QRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQR
VTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHS
FGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGAPAVVSCVPGPLYAASSGQKKQQQSK
PQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGA
RMGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS
GGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSG
NITEVVMSGVRCTGTELSLDQCAHHGTHITCKRTGTRFTAGVICSETASDLLLHSALVQE
TAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQ
GITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGH
RIWVHNCHIGDAFSEEANRRFERYPGQTSNQIINR
Download sequence
Identical sequences ENSGGOP00000027702 ENSGGOP00000006200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]