SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006218 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006218
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 46-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 365-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 187-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 273-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000152
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006218   Gene: ENSGGOG00000001955   Transcript: ENSGGOT00000006387
Sequence length 416
Comment pep:known_by_projection chromosome:gorGor3.1:19:20972898:20983818:-1 gene:ENSGGOG00000001955 transcript:ENSGGOT00000006387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGILVVLTPLKAYSQDSGVICPKNHLRRNSGEGGDKNKKKKRLGPLQFRDVAIEFSLE
EWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDFITCLEQGKKPLTMKKHEMVANPSV
TCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESVDECKVHKRGYNGLNQY
LTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGKAFNQPSTLTTHKKIHT
GEKPFKCEECGKAFNWSSHLTTHKIIHTGEKRYKCEDCGKAFSRFSYLTAHKIIHSGEKP
YKCEECGKAFKRSSILTAHKIIHTGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCE
ECGRAFKYFSSLTTHKIIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCE
Download sequence
Identical sequences ENSGGOP00000006218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]