SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006282 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006282
Domain Number 1 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-21
Family KRAB domain (Kruppel-associated box) 0.0006
Further Details:      
 
Domain Number 2 Region: 379-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 3 Region: 176-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 344-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 228-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 81-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000225
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 133-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000031
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006282
Domain Number - Region: 421-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0285
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006282   Gene: ENSGGOG00000006426   Transcript: ENSGGOT00000006451
Sequence length 471
Comment pep:novel chromosome:gorGor3.1:19:12466085:12469041:-1 gene:ENSGGOG00000006426 transcript:ENSGGOT00000006451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVTFEDVAVNFTQEEWALLDPSQKKLYRDVMWETFRNLATIDFFWVCISGTNRITRSGV
QNHMVERLCESKEGSHGGEGFSQIPNLSLNKKTPSGGKLWESSVCGKVLSHHSSLSRHIR
SYTRHKLYKCQEYGEKPYKCKKCGKPFSYLQLLKNIKEHTAGIVYKCKACGKAFLSTFFI
HGRTHTGDKPFKCKECGKAFRYHQSAQKHEKAHTGEKPYKCKECGKPFIYRHSARAHERN
HTVQKRYECKQCGKTYISSVGFQAHERTHTGEKPYECKKCGKVFVYHNSAQRHEKTHTGE
KPYKCKECGKAFYCCSSARRHERMHTAKKQYECKKCGKTYISCRFQIHERTHTGEKPYEC
KQCGKAFSSSVIFIHERIHTGEKPYECKECGKPFSFLTGFRVHMRMHTGEKPYKCKDCGN
AFIWRASLQYHVKKVHAEKKCKYRKFFNFNDFKVDMKVHTGELHECKYRKA
Download sequence
Identical sequences ENSGGOP00000006282 ENSGGOP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]