SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006362 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006362
Domain Number 1 Region: 190-238
Classification Level Classification E-value
Superfamily RING/U-box 0.0000388
Family RING finger domain, C3HC4 0.043
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006362
Domain Number - Region: 9-102
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0863
Family L-aspartase/fumarase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006362   Gene: ENSGGOG00000006501   Transcript: ENSGGOT00000006532
Sequence length 266
Comment pep:known_by_projection chromosome:gorGor3.1:16:28033997:28077781:-1 gene:ENSGGOG00000006501 transcript:ENSGGOT00000006532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQRHCYKVHDRNATVDKLEDFINNI
NSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSE
TGFASSTNILNLVDQLKGKKMRKKEAEQVLQKYVQNKWLIEKEGEFTLHGRAILEMEQYI
RETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIP
KVFDPEKERESGVLKSNKKALRSRQH
Download sequence
Identical sequences G3QUG0
ENSGGOP00000006362 XP_004057436.1.27298 XP_018867562.1.27298 ENSGGOP00000006362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]