SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006392 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006392
Domain Number 1 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 241-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.25e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 394-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000101
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000743
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006392
Domain Number - Region: 440-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000467
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006392   Gene: ENSGGOG00000001509   Transcript: ENSGGOT00000006562
Sequence length 482
Comment pep:novel chromosome:gorGor3.1:19:41263392:41275488:1 gene:ENSGGOG00000001509 transcript:ENSGGOT00000006562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMSKEAVTFKDVAVIFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHQDTFHFL
REEKFWMMDIATQREGNSGGKIQPEMKTFPEAGPHEGWSCQQIWEEIASDLTRPQDSTIK
SSQFFEQGDAHFQVEEGLSIMHTGQKPSDCGKCKQSFSDMSIFDLPQQIRSAEKSHSCDE
CGKSFCYISALHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRG
FRCRSALTVHCKLHMGEKHYNCEACGRAFIHDFQLQKHQRIHTGEKPFKCEICSVSFRLR
SSLNRHCVVHTGKKPNSTGEYGKGFVGRLDLCKHQMIHTGEKPYNCKECGKSFRRSSYLL
IHQRVHTGEKPYKCDKCGKSYITKSGLDLHHRAHTGERPYNCDDCGKSFRQASSILNHKR
LHCRKKPFKCEDCGKKLVYRSYRKDQQKNHSGENPSKCEDCGKRYKRRLNLDIILSLFLN
DT
Download sequence
Identical sequences ENSGGOP00000001490 ENSGGOP00000006392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]