SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006457 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006457
Domain Number 1 Region: 321-398
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-23
Family Intermediate filament protein, coiled coil region 0.00035
Further Details:      
 
Domain Number 2 Region: 90-124
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000262
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 211-322
Classification Level Classification E-value
Superfamily Prefoldin 0.000000654
Family Prefoldin 0.01
Further Details:      
 
Domain Number 4 Region: 136-199
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000136
Family Intermediate filament protein, coiled coil region 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006457   Gene: ENSGGOG00000006599   Transcript: ENSGGOT00000006628
Sequence length 469
Comment pep:known_by_projection chromosome:gorGor3.1:12:50250061:50265830:1 gene:ENSGGOG00000006599 transcript:ENSGGOT00000006628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG
AGIREVTINQSLLAPLRLDADPSLQRVRQEEREQIKTLNNKFASFIDKVRFLEQQNKLLE
TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY
EDEINRRAAAENEFVVLKKDVDAAYMTKVELEAKVDALNDEINFLRTLNETELTELQSQI
SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA
LQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG
GSSSGGGIGLTLGGTMGSNALSFSSSASPGPLKAYSIRTASTSRRSARN
Download sequence
Identical sequences ENSGGOP00000006457 ENSGGOP00000006457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]