SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006498 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006498
Domain Number 1 Region: 38-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-27
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 188-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 151-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006498   Gene: ENSGGOG00000006642   Transcript: ENSGGOT00000006669
Sequence length 402
Comment pep:known_by_projection chromosome:gorGor3.1:19:9013153:9024507:-1 gene:ENSGGOG00000006642 transcript:ENSGGOT00000006669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILPSTAAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWALL
DPAQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQDKKVMTEERGILPSTCPDLETLL
KAKWLTPKKHVFRKEQSKGVKTERSHRGVKLNECNQCFKVFSTKSNLTQHKRIHTGEKPY
DCSQCGKSFSSRSYLTIHKRIHNGEKPYECNHCGKAFSDPSSLRLHLRIHTGEKPYECNQ
CFHVFRTSCNLKSHKRIHTGENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECHDCGKT
FRKSSYLTQHVRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYECSDCGKAFNNL
SAVKKHLRTHTGEKPYECNHCGKSFTSNSYLSVHKRIHNRWI
Download sequence
Identical sequences A0A2I2ZNZ7
XP_004059985.1.27298 XP_004059986.1.27298 ENSGGOP00000006498 ENSGGOP00000006498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]