SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006545 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006545
Domain Number 1 Region: 301-347
Classification Level Classification E-value
Superfamily RING/U-box 0.000000202
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006545   Gene: ENSGGOG00000006689   Transcript: ENSGGOT00000006717
Sequence length 352
Comment pep:known_by_projection chromosome:gorGor3.1:1:21159566:21168352:-1 gene:ENSGGOG00000006689 transcript:ENSGGOT00000006717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPG
KCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPK
GIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLW
KVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS
ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS
Download sequence
Identical sequences A0A024RAA0 A0A0D9S8C5 G3QUY4 H2PY85 Q969V5
ENSP00000264198 HR5400 NP_078820.2.87134 NP_078820.2.92137 XP_003814451.1.60992 XP_007978400.1.81039 XP_018867592.1.27298 XP_513168.3.37143 ENSGGOP00000006545 9606.ENSP00000264198 ENSGGOP00000006545 gi|171542821|ref|NP_078820.2| ENSP00000264198 ENSP00000264198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]