SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006595 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006595
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily EF-hand 6.77e-23
Family S100 proteins 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006595   Gene: ENSGGOG00000006742   Transcript: ENSGGOT00000006768
Sequence length 92
Comment pep:known_by_projection chromosome:gorGor3.1:1:132348272:132350173:-1 gene:ENSGGOG00000006742 transcript:ENSGGOT00000006768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQLEEYLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Download sequence
Identical sequences G3QV32
ENSGGOP00000006595 XP_004026774.1.27298 ENSGGOP00000006595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]