SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006631 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006631
Domain Number 1 Region: 1148-1343
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 933-1056
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.000000459
Further Details:      
 
Domain Number 3 Region: 37-160
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-20
Family PDZ domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006631
Domain Number - Region: 625-706
Classification Level Classification E-value
Superfamily Connexin43 0.0955
Family Connexin43 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006631   Gene: ENSGGOG00000006767   Transcript: ENSGGOT00000006804
Sequence length 1962
Comment pep:novel chromosome:gorGor3.1:10:27764979:27906529:-1 gene:ENSGGOG00000006767 transcript:ENSGGOT00000006804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLSEGDGDKLKACEVSKNKDGKEQSETVSLSEDETFSWPGPKTVTLKRTSQGFG
FTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTG
DRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDA
YLKGNEAYSGNARNIPEPPPICYPWLPSAPSAMAQPIEISPPDSSLSKQQTSTPVLTQPG
RAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNNHTGPSHRTEEV
RYGVNEQTSLKTVSRTTSPPLSIPTTHLIHQPAGSRSLEPSGILLKSGNYSGHSDGISSS
RSQAVEAPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQS
TTDYNQVVPNRTTLQGRHRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGAL
TSPSVSFSNHRTRSWDYIEGQDETLENVNSGTPIPDSNGEIKQTYKWSGFTEQDDRRAIY
ERPRQQEIHKSFRGSNFAVAPSVVNSDNRRMSGRGVGSVSQFKKIPPDLKTLQSNRNFQT
TCGMSLPRGISQDRSPLVKVRSNSLKAPSTHVTKPSFSQKSLVSIKDQRPVNHLHQNSLL
NQQTWVRTDSAPDQQVETGKSPSLSGVSAKPAPQSSENAGTSDLELPVSQRNEDLSLQEA
EIEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREV
HIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATV
PPSLTTSAPLIRRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHVS
SLKGIKIADSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQM
YVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQ
AEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNLMSKAEQLPKTPRQSLSI
RQTLLGAKSEPKTQSPHSPKEESERKLVSKDWQSKDDTSPPKDKSTWRKGIPSIMRKTFE
KKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQ
EELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRL
KTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTH
MVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTG
VSPGDVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDE
LDNVFFKKENVEQCHNDTKEESKKESETLGRKQKIIIAKENSTRKDPSTTKDEKISLGKE
STPSEEPSPPRNSKHNKSPTLSCRFAILKESPRSLLAQKSSHLEETGSDSGTLLSTSSQA
SLTRFSMKKSTSPEMKHSEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKG
DEADDERSELISEGRPVETDSESEFPVFPTALTSERLFRGKLQEVTKSSRRNSEGSELSC
TEGSLTSSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKEAPSLTKVFDV
MKKGKSTGSLLTPTRGESEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKVNAETAKRK
SIRRRHTLGGHRDATEISVLNFWKVHEQSGERESELSAVNRLKPKCSAQDLSISDWLARE
RLRTSTSDLSRGEIGDPQTENPSTREIATTDTPLSLHCDTGSSSSTLASTNRPLLSIPPQ
SPDQINGESFQNVSKNASSAANAQPHKLSETPGSKAEFHPCL
Download sequence
Identical sequences ENSGGOP00000006631 ENSGGOP00000006631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]