SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006719 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006719
Domain Number 1 Region: 827-1120
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000206
Further Details:      
 
Domain Number 2 Region: 59-319
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.5e-79
Family Carbonic anhydrase 0.00000768
Further Details:      
 
Domain Number 3 Region: 1124-1410
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.24e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 347-441
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000722
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006719   Gene: ENSGGOG00000006858   Transcript: ENSGGOT00000006893
Sequence length 1445
Comment pep:known_by_projection chromosome:gorGor3.1:3:63110440:63809703:1 gene:ENSGGOG00000006858 transcript:ENSGGOT00000006893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGHHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQRLHDRVVSKSAVRDAWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
AASASKQAARPVLATTEALASPGPDGDSSPTKDSEGTEEGEKDEKSESEDGEREHEEDGE
KDSEKKEKSGVTHAAEEQNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRR
DAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAE
KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
PSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
CDQYWPTENSEEYGNIIVTLKSTKIHACYTVRCFSIRNTKMKKGQKGNPKGRQNERVVIQ
YHYTQWPDMGVPEYALPVLTFVRRSSAARMPEMGPVLVHCSAGVGRTGTYIVIDSMLQQI
KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWP
NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
QVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
MESLV
Download sequence
Identical sequences G3QVF1
ENSGGOP00000006719 ENSGGOP00000006719 XP_004034446.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]