SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006726 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006726
Domain Number 1 Region: 345-517
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-41
Family Ribonuclease PH domain 1-like 0.000046
Further Details:      
 
Domain Number 2 Region: 49-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.89e-36
Family Ribonuclease PH domain 1-like 0.00012
Further Details:      
 
Domain Number 3 Region: 185-273
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.15e-23
Family Ribonuclease PH domain 2-like 0.0019
Further Details:      
 
Domain Number 4 Region: 503-603
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-22
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 5 Region: 268-370
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.88e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000202
Further Details:      
 
Domain Number 6 Region: 597-687
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000614
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 7 Region: 678-757
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000181
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006726   Gene: ENSGGOG00000006867   Transcript: ENSGGOT00000006901
Sequence length 788
Comment pep:known_by_projection chromosome:gorGor3.1:2a:56653885:56714123:-1 gene:ENSGGOG00000006867 transcript:ENSGGOT00000006901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACRYCCSCLRLRPLSNGPFLLPGRDRALTQLQVRALWSSAGSRAVAVDLGNRKLEISS
GKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGTSDKEILTSRIIADRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSL
SDIPWNGPVGAVRIGIIDGEYVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQ
DFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPSPEIVKHTHKLAMERLYAVF
TDYEHDKVDRKQFVGKRVRVSTLKTVREKFPEADPYEIIESFNVVAKEVFRSIVLNEYKR
CDGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGI
KDKNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLE
SNGSSSMASACGGSLALMDSVIGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGI
EDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKP
RASRKENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSA
MHEARDFITEICKDDQEQQLEFGAVYTATITEISSIQVLIRLFFPMTFVLIHKHTSAKHS
IIKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIVMGEPI
SQSSSNSQ
Download sequence
Identical sequences ENSGGOP00000006726 ENSGGOP00000006726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]