SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006730 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006730
Domain Number 1 Region: 198-251
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 11-52
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000243
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 157-191
Classification Level Classification E-value
Superfamily RING/U-box 0.00000268
Family RING finger domain, C3HC4 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006730   Gene: ENSGGOG00000006874   Transcript: ENSGGOT00000006906
Sequence length 275
Comment pep:known_by_projection chromosome:gorGor3.1:5:165810920:165814769:-1 gene:ENSGGOG00000006874 transcript:ENSGGOT00000006906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWEAVGAVDGWDGS
VREVLYRGNADEELFQDQDDDELWLGDSSITNWDNVDYMWDEEEEEEEDQDDYLGGLRPD
LRIDVYGEEEILEAYDEDEEEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLA
NMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLP
LEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ
Download sequence
Identical sequences ENSGGOP00000006730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]