SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006795 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006795
Domain Number 1 Region: 581-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000004
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 618-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000168
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.00000576
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000886
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006795   Gene: ENSGGOG00000006947   Transcript: ENSGGOT00000006974
Sequence length 715
Comment pep:known_by_projection chromosome:gorGor3.1:6:99394815:99403639:1 gene:ENSGGOG00000006947 transcript:ENSGGOT00000006974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLTIQTSAHQVR
MVRGELVDESGGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSGGGGGAF
LHHEHAARQGAVPAADGLGLSPKPPAPDFAAPSQAGTLRPHPLGPPPVQACGAREGIKRE
ASSAPSATSPTPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGILGGSSAGVGSLAFYPG
VRSAFKPAGLARAAAAAHGDPYREESSSKQGAGLALGRLLGGGRAGGRPGSGENSAAGGA
GHHQHHHAHHHHHPKCLLAGDPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAA
AALPGARYAQLPPAPGLPLERCALPPLDQGGLKAYPGGECSHLPAVMPAFTVYNGELLYG
SPATTAYYPLKLHFGGLLKYPESISYFSGPAAAALSPAELGSLASIDREIAMHNQQLSEM
AAGKGRGRLDSGTLPPVVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHM
RTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSR
HPGQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL
Download sequence
Identical sequences ENSGGOP00000006795 ENSGGOP00000006795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]