SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006819 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006819
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 71-132
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006819
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0033
Family SCAN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006819   Gene: ENSGGOG00000006972   Transcript: ENSGGOT00000006998
Sequence length 526
Comment pep:known_by_projection chromosome:gorGor3.1:1:41917146:41933887:1 gene:ENSGGOG00000006972 transcript:ENSGGOT00000006998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTEASTWVKLQHPKKAVEGAPLWEDVTKMFEGEALLSQDAEDIKTQRESLE
DEVTPGLPTAESQELLTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDLKSKIETIESTAKSAISQERLYHGIMMESFMR
DDIIYSTLRKVSTYDDVLERHQETCVRDVRQAILTHKKRVQETNKFGENIIVRSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNTFRNNV
Download sequence
Identical sequences G3QVP1
ENSGGOP00000006819 XP_004025590.1.27298 XP_018871842.1.27298 ENSGGOP00000006819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]