SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007064 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007064
Domain Number 1 Region: 245-533
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000182
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007064
Domain Number - Region: 33-41
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007064   Gene: ENSGGOG00000007218   Transcript: ENSGGOT00000007250
Sequence length 541
Comment pep:known_by_projection chromosome:gorGor3.1:11:18973276:18990704:-1 gene:ENSGGOG00000007218 transcript:ENSGGOT00000007250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCYSQGLRCLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQKPPPRGAGSHSLTV
RSSLCLFAASQFLLACGVLWFSGYGHIWLQNATNLISSLLTLLKQLEPTAWLDSGTWGVP
SLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDD
FLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFG
YLMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVR
KNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFW
RMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVVYDGVEITVQKVIHTEDYRLRLISLKS
GTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTG
CFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSHQSP
E
Download sequence
Identical sequences ENSGGOP00000007064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]