SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007091 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007091
Domain Number 1 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 30-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 506-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007091   Gene: ENSGGOG00000004552   Transcript: ENSGGOT00000007277
Sequence length 568
Comment pep:known_by_projection chromosome:gorGor3.1:19:21406254:21440671:1 gene:ENSGGOG00000004552 transcript:ENSGGOT00000007277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENLKSGVYPLKEASGCPGADRNLLVYSFYEKGPLTFRDVAIEFSLEEWQCLDTAQQDLYR
KVMLENYRNLVFLAGIAVSKPDLITCLEQGKEPWSMKRHAMVDEPPVIYSHFAQDLWPEQ
GIKDSFQEVILRRYGKCGHEDLQLRTGCKSVDECNLHKECYDELNQCLTTTQSEIFQYDK
YVNVFYKFSNPNIQKIRHTGKKPFKCKKCDKSFCMLLHLTQHKRIHIRENSYQCEECGKV
FNWFSTLTRHRRIHTGEKPYKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKTFNRS
SHLTTHKRIHTGEKPYRCEECGRAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTLT
THKITHAGEKPYKCEECGKAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNRSSHLTTHKR
IHTGVKPYKCTECGKAFNRSSHLTTHRIIHTGEKPYKCEECGKAFNQSSTLTTHKITHAG
EKPYKCEECGKAFYRFSYLTKHKTSHTGEKFYKCEECGKGFNWSSALTKHKRIHTGEKPY
KCEECGKAFNESSNLTTDDSYWRETLQM
Download sequence
Identical sequences ENSGGOP00000007091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]