SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007139 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007139
Domain Number 1 Region: 208-275
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-23
Family RING finger domain, C3HC4 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007139   Gene: ENSGGOG00000007291   Transcript: ENSGGOT00000007325
Sequence length 304
Comment pep:known_by_projection chromosome:gorGor3.1:1:125290739:125375824:1 gene:ENSGGOG00000007291 transcript:ENSGGOT00000007325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGG
SRIDNSTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPR
LPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAW
GQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEE
VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQRQSTEASASNRFSNDSQLHD
RWTF
Download sequence
Identical sequences G3QWI0
XP_004026539.1.27298 ENSGGOP00000007139 ENSGGOP00000007139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]