SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007539 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007539
Domain Number 1 Region: 29-203
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.1e-52
Family MHC antigen-recognition domain 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007539   Gene: ENSGGOG00000007707   Transcript: ENSGGOT00000007741
Sequence length 243
Comment pep:known_by_projection chromosome:gorGor3.1:6:150944281:150950745:1 gene:ENSGGOG00000007707 transcript:ENSGGOT00000007741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERP
FLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLT
LQARMSCEHEAHGLGRGSWQFVFNGQKFLLFDSNNRKWTALHPGANKMTEKWENRDVTMF
FQKISLGDCKMWLEEFLMYWEQMLDPTKRPSLAPGTTQPKAMATTLSPWSLLIIFLCFIL
AGR
Download sequence
Identical sequences A0A2I2ZU65
ENSGGOP00000007539 XP_018884484.1.27298 ENSGGOP00000007539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]