SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007606 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007606
Domain Number 1 Region: 46-108
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007606   Gene: ENSGGOG00000007778   Transcript: ENSGGOT00000007808
Sequence length 217
Comment pep:known_by_projection chromosome:gorGor3.1:6:73132248:73133744:1 gene:ENSGGOG00000007778 transcript:ENSGGOT00000007808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGG
ERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGK
ALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQ
QSLQAANQSGTQRSPEAASKAVTQRFREDARDPVTRL
Download sequence
Identical sequences G3QXQ1
ENSGGOP00000007606 ENSGGOP00000007606 XP_004044338.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]