SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007661 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007661
Domain Number 1 Region: 41-189
Classification Level Classification E-value
Superfamily EF-hand 1.76e-36
Family Calmodulin-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007661   Gene: ENSGGOG00000007834   Transcript: ENSGGOT00000007867
Sequence length 196
Comment pep:known_by_projection chromosome:gorGor3.1:15:47528419:47545710:-1 gene:ENSGGOG00000007834 transcript:ENSGGOT00000007867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEHLLPGPPPSLADFRLEAGEKGTERGSGSSKPTGSSRGPRMAKFLSQDQINEYKECF
SLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGDLDFSTFLTIMHMQI
KQEDPRKEILLAMLMADKEKKGYIMASDLRSKLTSLGEKLTHKEVDDLFKEGDIEPNGKV
KYDEFIHKITLPGRDY
Download sequence
Identical sequences A0A2I2ZPK5
ENSGGOP00000007661 ENSGGOP00000007661 XP_004056430.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]