SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007673 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007673
Domain Number 1 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 222-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 376-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 186-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007673   Gene: ENSGGOG00000007848   Transcript: ENSGGOT00000007880
Sequence length 438
Comment pep:known_by_projection chromosome:gorGor3.1:2a:92787300:92804778:1 gene:ENSGGOG00000007848 transcript:ENSGGOT00000007880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSPTTRCQESVTFEDVAVVFTDEEWSHLVPIQRDLYKEVMLENYNSIVSLGLPVPQP
DVIFQLKRGDKPWMVDLHGSEEREWPESVSLAQEKNCICFLFVPDWETKPEIYNASDKKS
EASLRECLGRQSPLCPKFEVHTPDGRMGTEKQSPSGETRKKSLSRGKGLRRGSALSREIL
TKERHQECSDCGKTFFDHSSLTRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGES
PYECSVCAKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIHTGESPYEC
HQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECG
KAFFDRSSLTQHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECTVCGKVFS
SKSSVIQHQRRYAKQGID
Download sequence
Identical sequences ENSGGOP00000007673 ENSGGOP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]