SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007998 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007998
Domain Number 1 Region: 549-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-81
Family Protein kinases, catalytic subunit 0.000000947
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.4e-54
Family FCH domain 0.0099
Further Details:      
 
Domain Number 3 Region: 440-578
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-27
Family SH2 domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007998   Gene: ENSGGOG00000008174   Transcript: ENSGGOT00000008218
Sequence length 822
Comment pep:known_by_projection chromosome:gorGor3.1:15:70717362:70729138:1 gene:ENSGGOG00000008174 transcript:ENSGGOT00000008218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLVPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVILHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR
Download sequence
Identical sequences G3QYQ6
ENSGGOP00000007998 ENSGGOP00000007998 XP_004056818.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]